PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_39334_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 116aa    MW: 13262.9 Da    PI: 10.4085
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_39334_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.14.5e-4224100278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     C v+gC adl+++++yhrrhkvCe hsk+p+v+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Neem_39334_f_1  24 CLVDGCVADLAKCRDYHRRHKVCELHSKTPKVTIQGHEQRFCQQCSRFHSLVEFDEGKRSCRKRLDGHNRRRRKPQP 100
                     **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.1E-351685IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.8642198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3922103IPR004333Transcription factor, SBP-box
PfamPF031107.9E-312497IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MESSASSSSK RARAPSNGNQ VPSCLVDGCV ADLAKCRDYH RRHKVCELHS KTPKVTIQGH  60
EQRFCQQCSR FHSLVEFDEG KRSCRKRLDG HNRRRRKPQP DSLSINSGRF FPEHQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-301497184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18097KRSCRKRLDGHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043940.11e-70Squamosa promoter-binding protein transcription factor family protein, putative isoform 1
SwissprotB9DI203e-47SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI113e-47SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLA0A061E6062e-70A0A061E606_THECC; Squamosa promoter-binding protein transcription factor family protein, putative isoform 1
STRINGVIT_01s0010g03910.t011e-58(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-47SBP family protein